SCOP 1.69: Domain d1axkb2: 1axk B:157-341

Lineage for d1axkb2 (1axk B:157-341)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus subtilis [TaxId:1423] [49981] (1 PDB entry)

8. Domain d1axkb2: 1axk B:157-341 [24316]
   Other proteins in same PDB: d1axka1, d1axkb1
   inserted into a beta-glucanase domain from Bacillus macerans

Details for d1axkb2

PDB Entry: 1axk, 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1

SCOP Domain Sequences for d1axkb2:

Sequence; same for both SEQRES and ATOM records:

>d1axkb2 b.29.1.11 (B:157-341) Xylanase II {Bacillus subtilis}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1axkb2:

• d1axkb2 first appeared (with stable ids) in SCOP 1.55
  
• d1axkb2 appears in SCOP 1.67
  
• d1axkb2 appears in SCOP 1.71
  
• d1axkb2 appears in the current release, SCOPe 2.08