Lineage for d2mala_ (2mal A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714949Family a.52.1.0: automated matches [254196] (1 protein)
    not a true family
  6. 2714950Protein automated matches [254428] (8 species)
    not a true protein
  7. 2714962Species Common lentil (Lens culinaris) [TaxId:3864] [255496] (3 PDB entries)
  8. 2714965Domain d2mala_: 2mal A: [243158]
    automated match to d2alga_

Details for d2mala_

PDB Entry: 2mal (more details)

PDB Description: solution structure of lipid transfer protein from lentil lens culinaris
PDB Compounds: (A:) Non-specific lipid-transfer protein 2

SCOPe Domain Sequences for d2mala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mala_ a.52.1.0 (A:) automated matches {Common lentil (Lens culinaris) [TaxId: 3864]}
aiscgavtsdlspcltyltggpgpspqccggvkkllaaanttpdrqaacnclksaagsit
klntnnaaalpgkcgvnipykistttncntvkf

SCOPe Domain Coordinates for d2mala_:

Click to download the PDB-style file with coordinates for d2mala_.
(The format of our PDB-style files is described here.)

Timeline for d2mala_: