Lineage for d2ma9c_ (2ma9 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647424Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1647551Protein automated matches [232759] (2 species)
    not a true protein
  7. 1647552Species Human (Homo sapiens) [TaxId:9606] [232779] (2 PDB entries)
  8. 1647554Domain d2ma9c_: 2ma9 C: [243157]
    Other proteins in same PDB: d2ma9b_
    automated match to d4b9kb_

Details for d2ma9c_

PDB Entry: 2ma9 (more details)

PDB Description: hiv-1 vif socs-box and elongin bc solution structure
PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d2ma9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ma9c_ d.42.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyft
ykvrytnssteipefpiapeialellmaanf

SCOPe Domain Coordinates for d2ma9c_:

Click to download the PDB-style file with coordinates for d2ma9c_.
(The format of our PDB-style files is described here.)

Timeline for d2ma9c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ma9b_