Lineage for d2ma9c_ (2ma9 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945723Domain d2ma9c_: 2ma9 C: [243157]
    Other proteins in same PDB: d2ma9b_
    automated match to d4b9kb_

Details for d2ma9c_

PDB Entry: 2ma9 (more details)

PDB Description: hiv-1 vif socs-box and elongin bc solution structure
PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d2ma9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ma9c_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
vklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyft
ykvrytnssteipefpiapeialellmaanf

SCOPe Domain Coordinates for d2ma9c_:

Click to download the PDB-style file with coordinates for d2ma9c_.
(The format of our PDB-style files is described here.)

Timeline for d2ma9c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ma9b_