Lineage for d2ma1a_ (2ma1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716244Superfamily a.60.8: HRDC-like [47819] (5 families) (S)
  5. 2716292Family a.60.8.0: automated matches [254263] (1 protein)
    not a true family
  6. 2716293Protein automated matches [254609] (1 species)
    not a true protein
  7. 2716294Species Deinococcus radiodurans [TaxId:243230] [255494] (1 PDB entry)
  8. 2716295Domain d2ma1a_: 2ma1 A: [243155]
    automated match to d1wuda1

Details for d2ma1a_

PDB Entry: 2ma1 (more details)

PDB Description: Solution structure of HRDC1 domain of RecQ helicase from Deinococcus radiodurans
PDB Compounds: (A:) DNA helicase RecQ

SCOPe Domain Sequences for d2ma1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ma1a_ a.60.8.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
hdaplfealrawrlqkakelslppytifhdatlktiaelrpgshatlgtvsgvggrklaa
ygdevlqvvrdssgg

SCOPe Domain Coordinates for d2ma1a_:

Click to download the PDB-style file with coordinates for d2ma1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ma1a_: