SCOPe 2.08: Domain d2m9xa1: 2m9x A:12-112

Lineage for d2m9xa1 (2m9x A:12-112)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.10: MAST3 pre-PK domain-like [140482] (1 family)
   this domain precedes the Protein Kinase domain in Microtubule-associated serine/threonine-protein kinase 3 (MAST3)
   automatically mapped to Pfam PF08926

5. Family a.29.10.1: MAST3 pre-PK domain-like [140483] (2 proteins)

6. Protein automated matches [254607] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255492] (1 PDB entry)

8. Domain d2m9xa1: 2m9x A:12-112 [243153]
   Other proteins in same PDB: d2m9xa2
   automated match to d1v9va1

Details for d2m9xa1

PDB Entry: 2m9x

PDB Description: Solution NMR Structure of Microtubule-associated serine/threonine-protein kinase 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9151A

PDB Compounds: (A:) Microtubule-associated serine/threonine-protein kinase 1

SCOPe Domain Sequences for d2m9xa1:

Sequence; same for both SEQRES and ATOM records:

>d2m9xa1 a.29.10.1 (A:12-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkataqmeeklrdftrayepdsvlpladgvlsfihhqiielardcltksrdglittvyfy
elqenlekllqdayerseslevafvtqlvkklliiisrpar

Timeline for d2m9xa1:

• d2m9xa1 first appeared in SCOPe 2.04, called d2m9xa_
  
• d2m9xa1 appears in SCOPe 2.07