Lineage for d2m9xa1 (2m9x A:12-112)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708890Superfamily a.29.10: MAST3 pre-PK domain-like [140482] (1 family) (S)
    this domain precedes the Protein Kinase domain in Microtubule-associated serine/threonine-protein kinase 3 (MAST3)
    automatically mapped to Pfam PF08926
  5. 2708891Family a.29.10.1: MAST3 pre-PK domain-like [140483] (2 proteins)
  6. 2708895Protein automated matches [254607] (1 species)
    not a true protein
  7. 2708896Species Human (Homo sapiens) [TaxId:9606] [255492] (1 PDB entry)
  8. 2708897Domain d2m9xa1: 2m9x A:12-112 [243153]
    Other proteins in same PDB: d2m9xa2
    automated match to d1v9va1

Details for d2m9xa1

PDB Entry: 2m9x (more details)

PDB Description: Solution NMR Structure of Microtubule-associated serine/threonine-protein kinase 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9151A
PDB Compounds: (A:) Microtubule-associated serine/threonine-protein kinase 1

SCOPe Domain Sequences for d2m9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m9xa1 a.29.10.1 (A:12-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkataqmeeklrdftrayepdsvlpladgvlsfihhqiielardcltksrdglittvyfy
elqenlekllqdayerseslevafvtqlvkklliiisrpar

SCOPe Domain Coordinates for d2m9xa1:

Click to download the PDB-style file with coordinates for d2m9xa1.
(The format of our PDB-style files is described here.)

Timeline for d2m9xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m9xa2