Lineage for d2m99a_ (2m99 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032807Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 3032808Protein automated matches [190829] (14 species)
    not a true protein
  7. 3032809Species Chinese cobra (Naja atra) [TaxId:8656] [255490] (1 PDB entry)
  8. 3032810Domain d2m99a_: 2m99 A: [243150]
    automated match to d1dtxa_

Details for d2m99a_

PDB Entry: 2m99 (more details)

PDB Description: Solution structure of a chymotrypsin inhibitor from the Taiwan cobra
PDB Compounds: (A:) Protease inhibitor NACI

SCOPe Domain Sequences for d2m99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m99a_ g.8.1.0 (A:) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
rprfcelapsagscfafvpsyyynqysntchsftysgcggnanrfrtidecnrtcvg

SCOPe Domain Coordinates for d2m99a_:

Click to download the PDB-style file with coordinates for d2m99a_.
(The format of our PDB-style files is described here.)

Timeline for d2m99a_: