Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (14 species) not a true protein |
Species Chinese cobra (Naja atra) [TaxId:8656] [255490] (1 PDB entry) |
Domain d2m99a_: 2m99 A: [243150] automated match to d1dtxa_ |
PDB Entry: 2m99 (more details)
SCOPe Domain Sequences for d2m99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m99a_ g.8.1.0 (A:) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]} rprfcelapsagscfafvpsyyynqysntchsftysgcggnanrfrtidecnrtcvg
Timeline for d2m99a_: