Lineage for d2m8pa1 (2m8p A:1-147)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495228Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1495229Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1495230Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1495269Protein HIV-1 capsid protein [47945] (1 species)
  7. 1495270Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (30 PDB entries)
  8. 1495342Domain d2m8pa1: 2m8p A:1-147 [243146]
    Other proteins in same PDB: d2m8pa2
    automated match to d3ntea1
    mutant

Details for d2m8pa1

PDB Entry: 2m8p (more details)

PDB Description: the structure of the w184am185a mutant of the hiv-1 capsid protein
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2m8pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m8pa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d2m8pa1:

Click to download the PDB-style file with coordinates for d2m8pa1.
(The format of our PDB-style files is described here.)

Timeline for d2m8pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m8pa2