Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (6 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries) |
Domain d2m8na2: 2m8n A:148-221 [243145] Other proteins in same PDB: d2m8na1 automated match to d3ntea2 |
PDB Entry: 2m8n (more details)
SCOPe Domain Sequences for d2m8na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m8na2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacqgv
Timeline for d2m8na2: