SCOPe 2.04: Domain d2m8na2: 2m8n A:148-221

Lineage for d2m8na2 (2m8n A:148-221)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (6 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries)

8. Domain d2m8na2: 2m8n A:148-221 [243145]
   Other proteins in same PDB: d2m8na1
   automated match to d3ntea2

Details for d2m8na2

PDB Entry: 2m8n

PDB Description: hiv-1 capsid monomer structure

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2m8na2:

Sequence; same for both SEQRES and ATOM records:

>d2m8na2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

Timeline for d2m8na2:

• d2m8na2 is new in SCOPe 2.04-stable
  
• d2m8na2 appears in SCOPe 2.05
  
• d2m8na2 appears in the current release, SCOPe 2.08