Lineage for d2m8la2 (2m8l A:148-221)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319355Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2319709Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2319801Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2319802Protein automated matches [191156] (12 species)
    not a true protein
  7. 2319927Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries)
  8. 2319929Domain d2m8la2: 2m8l A:148-221 [243141]
    Other proteins in same PDB: d2m8la1, d2m8lb1
    automated match to d3ntea2

Details for d2m8la2

PDB Entry: 2m8l (more details)

PDB Description: hiv capsid dimer structure
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2m8la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m8la2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

SCOPe Domain Coordinates for d2m8la2:

Click to download the PDB-style file with coordinates for d2m8la2.
(The format of our PDB-style files is described here.)

Timeline for d2m8la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m8la1