SCOP 1.73: Domain d1c5ia_: 1c5i A:

Lineage for d1c5ia_ (1c5i A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (10 PDB entries)

8. Domain d1c5ia_: 1c5i A: [24314]
   complexed with dfx, xys; mutant

Details for d1c5ia_

PDB Entry: 1c5i, 1.8 Å

PDB Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOP Domain Sequences for d1c5ia_:

Sequence; same for both SEQRES and ATOM records:

>d1c5ia_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1c5ia_:

• d1c5ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1c5ia_ appears in SCOP 1.71
  
• d1c5ia_ appears in SCOP 1.75
  
• d1c5ia_ appears in the current release, SCOPe 2.08