Lineage for d1c5ia_ (1c5i A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 58044Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)
  6. 58056Protein Xylanase II [49979] (11 species)
  7. 58069Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)
  8. 58078Domain d1c5ia_: 1c5i A: [24314]

Details for d1c5ia_

PDB Entry: 1c5i (more details), 1.8 Å

PDB Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase

SCOP Domain Sequences for d1c5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ia_ b.29.1.11 (A:) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1c5ia_:

Click to download the PDB-style file with coordinates for d1c5ia_.
(The format of our PDB-style files is described here.)

Timeline for d1c5ia_: