| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein automated matches [190140] (37 species) not a true protein |
| Species Escherichia coli [TaxId:536056] [255489] (2 PDB entries) |
| Domain d2m8ca_: 2m8c A: [243137] automated match to d1hsla_ |
PDB Entry: 2m8c (more details)
SCOPe Domain Sequences for d2m8ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m8ca_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 536056]}
aipqnirigtdptyapfesknsqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptveslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpsvkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg
Timeline for d2m8ca_: