Lineage for d2m87a_ (2m87 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695352Species Klebsiella pneumoniae [TaxId:1185418] [255488] (1 PDB entry)
  8. 2695353Domain d2m87a_: 2m87 A: [243136]
    automated match to d1gxpb_

Details for d2m87a_

PDB Entry: 2m87 (more details)

PDB Description: structural basis of dna recognition by the effector domain of klebsiella pneumoniae pmra
PDB Compounds: (A:) Transcriptional regulatory protein basR/pmrA

SCOPe Domain Sequences for d2m87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m87a_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1185418]}
nqgdneisvgnlrlnvtrrlvwlgetaldltpkeyallsrlmmkagspvhreilyndiys
wdnepatntlevhihnlrekigksrirtvrgfgymlannidte

SCOPe Domain Coordinates for d2m87a_:

Click to download the PDB-style file with coordinates for d2m87a_.
(The format of our PDB-style files is described here.)

Timeline for d2m87a_: