| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
| Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
| Protein automated matches [190838] (19 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [197087] (8 PDB entries) |
| Domain d2m7ua1: 2m7u A:430-591 [243134] Other proteins in same PDB: d2m7ua2, d2m7ua3 automated match to d4fofa_ complexed with vrb |
PDB Entry: 2m7u (more details)
SCOPe Domain Sequences for d2m7ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m7ua1 d.110.2.0 (A:430-591) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aavqlselrdrqaifetlvakgrellacdrvivyafddnyvgtvvaesvaegwpqardqv
iedpcfrehwveayrqgriqattdifkagltechlnqlrplkvranlvvpmviddqlfgl
liahqaseprqwqeieidqfselastgslvlerlhfleqtia
Timeline for d2m7ua1: