Lineage for d2m7ka_ (2m7k A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734343Protein automated matches [190064] (20 species)
    not a true protein
  7. 1734366Species Entamoeba histolytica [TaxId:294381] [225835] (3 PDB entries)
  8. 1734372Domain d2m7ka_: 2m7k A: [243132]
    automated match to d3li6d_

Details for d2m7ka_

PDB Entry: 2m7k (more details)

PDB Description: NMR solution structure of N-terminal domain of (Y81F)-EhCaBP1
PDB Compounds: (A:) calcium-binding protein

SCOPe Domain Sequences for d2m7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m7ka_ a.39.1.5 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
fygsiq

SCOPe Domain Coordinates for d2m7ka_:

Click to download the PDB-style file with coordinates for d2m7ka_.
(The format of our PDB-style files is described here.)

Timeline for d2m7ka_: