Lineage for d1bvv__ (1bvv -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556586Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 556625Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 556646Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)
  8. 556654Domain d1bvv__: 1bvv - [24313]
    complexed with dfx, xys

Details for d1bvv__

PDB Entry: 1bvv (more details), 1.8 Å

PDB Description: sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase

SCOP Domain Sequences for d1bvv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvv__ b.29.1.11 (-) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1bvv__:

Click to download the PDB-style file with coordinates for d1bvv__.
(The format of our PDB-style files is described here.)

Timeline for d1bvv__: