SCOPe 2.04: Domain d2m6ya_: 2m6y A:

Lineage for d2m6ya_ (2m6y A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255094] (9 PDB entries)

8. Domain d2m6ya_: 2m6y A: [243122]
   automated match to d2ocha_

Details for d2m6ya_

PDB Entry: 2m6y

PDB Description: the solution structure of the j-domain of human dnaja1

PDB Compounds: (A:) DnaJ homolog subfamily A member 1

SCOPe Domain Sequences for d2m6ya_:

Sequence; same for both SEQRES and ATOM records:

>d2m6ya_ a.2.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhshmvkettyydvlgvkpnatqeelkkayrklalkyhpdknpnegekfkqisq
ayevlsdakkrelydkg

Timeline for d2m6ya_:

• d2m6ya_ is new in SCOPe 2.04-stable
  
• d2m6ya_ appears in SCOPe 2.05
  
• d2m6ya_ appears in the current release, SCOPe 2.08, called d2m6ya1