Lineage for d2m6ya1 (2m6y A:11-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689904Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2689905Protein automated matches [190750] (8 species)
    not a true protein
  7. 2689916Species Human (Homo sapiens) [TaxId:9606] [255094] (10 PDB entries)
  8. 2689917Domain d2m6ya1: 2m6y A:11-77 [243122]
    Other proteins in same PDB: d2m6ya2
    automated match to d2ocha_

Details for d2m6ya1

PDB Entry: 2m6y (more details)

PDB Description: the solution structure of the j-domain of human dnaja1
PDB Compounds: (A:) DnaJ homolog subfamily A member 1

SCOPe Domain Sequences for d2m6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m6ya1 a.2.3.0 (A:11-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvkettyydvlgvkpnatqeelkkayrklalkyhpdknpnegekfkqisqayevlsdakk
relydkg

SCOPe Domain Coordinates for d2m6ya1:

Click to download the PDB-style file with coordinates for d2m6ya1.
(The format of our PDB-style files is described here.)

Timeline for d2m6ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m6ya2