Lineage for d2m5wa_ (2m5w A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1723166Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [255485] (1 PDB entry)
  8. 1723167Domain d2m5wa_: 2m5w A: [243120]
    automated match to d1s29a_

Details for d2m5wa_

PDB Entry: 2m5w (more details)

PDB Description: NMR Solution Structure of the La motif (N-terminal Domain, NTD) of Dictyostelium discoideum La protein
PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d2m5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m5wa_ a.4.5.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
mseetstqilkqveyyfsdsnfprdkflrseaaknvdnyisidviasfnrmktistdlql
itealkkstrlqvsedgkmvrrldplpenid

SCOPe Domain Coordinates for d2m5wa_:

Click to download the PDB-style file with coordinates for d2m5wa_.
(The format of our PDB-style files is described here.)

Timeline for d2m5wa_: