Lineage for d2m5ca_ (2m5c A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679371Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1679372Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1679385Species Bacillus cereus [TaxId:1396] [56284] (20 PDB entries)
    Uniprot P04190 31-257
  8. 1679414Domain d2m5ca_: 2m5c A: [243117]
    automated match to d3i11a_
    complexed with zn

Details for d2m5ca_

PDB Entry: 2m5c (more details)

PDB Description: solution structure of the bacillus cereus metallo-beta-lactamase bcii
PDB Compounds: (A:) Beta-lactamase 2

SCOPe Domain Sequences for d2m5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m5ca_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d2m5ca_:

Click to download the PDB-style file with coordinates for d2m5ca_.
(The format of our PDB-style files is described here.)

Timeline for d2m5ca_: