Lineage for d2m5ab_ (2m5a B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2697064Protein automated matches [191290] (5 species)
    not a true protein
  7. 2697065Species Artificial gene [TaxId:32630] [255483] (1 PDB entry)
  8. 2697066Domain d2m5ab_: 2m5a B: [243116]
    Other proteins in same PDB: d2m5aa1, d2m5aa2
    automated match to d1h0ta_

Details for d2m5ab_

PDB Entry: 2m5a (more details)

PDB Description: Protein A binding by an engineered Affibody molecule
PDB Compounds: (B:) ZpA963

SCOPe Domain Sequences for d2m5ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m5ab_ a.8.1.1 (B:) automated matches {Artificial gene [TaxId: 32630]}
vdnkfnketqeasweiftlpnlngrqvaafissllddpsqsanllaeakklndaqapk

SCOPe Domain Coordinates for d2m5ab_:

Click to download the PDB-style file with coordinates for d2m5ab_.
(The format of our PDB-style files is described here.)

Timeline for d2m5ab_: