Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (118 PDB entries) Uniprot P00183 |
Domain d2m56a_: 2m56 A: [243113] Other proteins in same PDB: d2m56b_ automated match to d3fwgb_ complexed with cam, fes, hem |
PDB Entry: 2m56 (more details)
SCOPe Domain Sequences for d2m56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m56a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d2m56a_: