Lineage for d2m56a_ (2m56 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005309Domain d2m56a_: 2m56 A: [243113]
    Other proteins in same PDB: d2m56b_
    automated match to d3fwgb_
    complexed with cam, fes, hem

Details for d2m56a_

PDB Entry: 2m56 (more details)

PDB Description: The structure of the complex of cytochrome P450cam and its electron donor putidaredoxin determined by paramagnetic NMR spectroscopy
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d2m56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m56a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2m56a_:

Click to download the PDB-style file with coordinates for d2m56a_.
(The format of our PDB-style files is described here.)

Timeline for d2m56a_: