SCOP 1.71: Domain d1c5ha_: 1c5h A:

Lineage for d1c5ha_ (1c5h A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)

8. Domain d1c5ha_: 1c5h A: [24311]
   mutant

Details for d1c5ha_

PDB Entry: 1c5h, 1.55 Å

PDB Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase

SCOP Domain Sequences for d1c5ha_:

Sequence; same for both SEQRES and ATOM records:

>d1c5ha_ b.29.1.11 (A:) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1c5ha_:

• d1c5ha_ first appeared (with stable ids) in SCOP 1.55
  
• d1c5ha_ appears in SCOP 1.69
  
• d1c5ha_ appears in SCOP 1.73
  
• d1c5ha_ appears in the current release, SCOPe 2.08