Lineage for d2m4na_ (2m4n A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638602Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (1 PDB entry)
  8. 1638603Domain d2m4na_: 2m4n A: [243106]
    automated match to d1wxaa1

Details for d2m4na_

PDB Entry: 2m4n (more details)

PDB Description: Solution structure of the putative Ras interaction domain of AFD-1, isoform a from Caenorhabditis elegans
PDB Compounds: (A:) Protein AFD-1, isoform a

SCOPe Domain Sequences for d2m4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m4na_ d.15.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
smfggslkvyggeivptrpyvsilaeinenadrilgaalekyglehskddfilvevsndd
drksmsdlreidgrpipptecplfemtarsgngengfdsflaikrkph

SCOPe Domain Coordinates for d2m4na_:

Click to download the PDB-style file with coordinates for d2m4na_.
(The format of our PDB-style files is described here.)

Timeline for d2m4na_: