SCOPe 2.05: Domain d2m49d_: 2m49 D:

Lineage for d2m49d_ (2m49 D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries)

8. Domain d2m49d_: 2m49 D: [243105]
   Other proteins in same PDB: d2m49a_, d2m49c_
   automated match to d2prua1

Details for d2m49d_

PDB Entry: 2m49

PDB Description: Structural Insights into Human S100B and Basic Fibroblast Growth Factor (FGF2) Interaction

PDB Compounds: (D:) Protein S100-B

SCOPe Domain Sequences for d2m49d_:

Sequence; same for both SEQRES and ATOM records:

>d2m49d_ a.39.1.2 (D:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

Timeline for d2m49d_:

• d2m49d_ first appeared in SCOPe 2.04
  
• d2m49d_ appears in SCOPe 2.06
  
• d2m49d_ appears in the current release, SCOPe 2.08