SCOPe 2.07: Domain d2m49c_: 2m49 C:

Lineage for d2m49c_ (2m49 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein automated matches [190637] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries)

8. Domain d2m49c_: 2m49 C: [243104]
   Other proteins in same PDB: d2m49b_, d2m49d_
   automated match to d1ev2a_

Details for d2m49c_

PDB Entry: 2m49

PDB Description: Structural Insights into Human S100B and Basic Fibroblast Growth Factor (FGF2) Interaction

PDB Compounds: (C:) fibroblast growth factor 2

SCOPe Domain Sequences for d2m49c_:

Sequence; same for both SEQRES and ATOM records:

>d2m49c_ b.42.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamke
dgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
flpmsa

Timeline for d2m49c_:

• d2m49c_ first appeared in SCOPe 2.04
  
• d2m49c_ appears in SCOPe 2.06
  
• d2m49c_ appears in the current release, SCOPe 2.08