![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
![]() | Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) ![]() |
![]() | Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins) |
![]() | Protein automated matches [254447] (3 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11698] [255478] (1 PDB entry) |
![]() | Domain d2m3za_: 2m3z A: [243100] automated match to d1mfsa_ complexed with 1hf, zn |
PDB Entry: 2m3z (more details)
SCOPe Domain Sequences for d2m3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m3za_ g.40.1.1 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} iqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan
Timeline for d2m3za_: