SCOP 1.65: Domain d1xnc__: 1xnc -

Lineage for d1xnc__ (1xnc -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (15 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)

8. Domain d1xnc__: 1xnc - [24310]
   mutant

Details for d1xnc__

PDB Entry: 1xnc, 1.6 Å

PDB Description: thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide bonds

SCOP Domain Sequences for d1xnc__:

Sequence; same for both SEQRES and ATOM records:

>d1xnc__ b.29.1.11 (-) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvkcdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftchvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1xnc__:

• d1xnc__ first appeared (with stable ids) in SCOP 1.55
  
• d1xnc__ appears in SCOP 1.63
  
• d1xnc__ appears in SCOP 1.67
  
• d1xnc__ appears in the current release, SCOPe 2.08, called d1xnca_