Lineage for d1xnc__ (1xnc -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) 
Protein Xylanase II [49979] (11 species) Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries) 
Domain d1xnc__: 1xnc - [24310]
Details for d1xnc__
PDB Entry: 1xnc (more details), 1.6 Å
PDB Description: thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide bonds
SCOP Domain Sequences for d1xnc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnc__ b.29.1.11 (-) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvkcdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftchvnawkshgmnlgsnwayqvmategyqssgss
nvtvw
SCOP Domain Coordinates for d1xnc__:
Click to download the PDB-style file with coordinates for d1xnc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xnc__:
- d1xnc__ first appeared (with stable ids) in SCOP 1.55
- d1xnc__ appears in SCOP 1.59
- d1xnc__ appears in the current release, SCOPe 2.08, called d1xnca_
View in 3D