| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
| Protein automated matches [191109] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries) |
| Domain d2m3ua2: 2m3u A:92-178 [243097] Other proteins in same PDB: d2m3ua3 automated match to d1i5ia2 |
PDB Entry: 2m3u (more details)
SCOPe Domain Sequences for d2m3ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m3ua2 b.11.1.0 (A:92-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive
Timeline for d2m3ua2: