Lineage for d2m3ta2 (2m3t A:92-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773666Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)
  8. 2773686Domain d2m3ta2: 2m3t A:92-178 [243095]
    Other proteins in same PDB: d2m3ta3
    automated match to d1i5ia2

Details for d2m3ta2

PDB Entry: 2m3t (more details)

PDB Description: Solution-state NMR structure of wild-type human gamma(S)-crystallin
PDB Compounds: (A:) Beta-crystallin S

SCOPe Domain Sequences for d2m3ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m3ta2 b.11.1.0 (A:92-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive

SCOPe Domain Coordinates for d2m3ta2:

Click to download the PDB-style file with coordinates for d2m3ta2.
(The format of our PDB-style files is described here.)

Timeline for d2m3ta2: