SCOPe 2.05: Domain d2m3ta1: 2m3t A:1-91

Lineage for d2m3ta1 (2m3t A:1-91)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230909] (9 PDB entries)

8. Domain d2m3ta1: 2m3t A:1-91 [243094]
   automated match to d1i5ia1

Details for d2m3ta1

PDB Entry: 2m3t

PDB Description: Solution-state NMR structure of wild-type human gamma(S)-crystallin

PDB Compounds: (A:) Beta-crystallin S

SCOPe Domain Sequences for d2m3ta1:

Sequence; same for both SEQRES and ATOM records:

>d2m3ta1 b.11.1.0 (A:1-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsktgtkitfyedknfqgrrydcdcdcadfhtylsrcnsikveggtwavyerpnfagymy
ilpqgeypeyqrwmglndrlsscravhlpsg

Timeline for d2m3ta1:

• d2m3ta1 first appeared in SCOPe 2.04
  
• d2m3ta1 appears in SCOPe 2.06
  
• d2m3ta1 appears in the current release, SCOPe 2.08