SCOPe 2.06: Domain d2m3da1: 2m3d A:2-95

Lineage for d2m3da1 (2m3d A:2-95)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d2m3da1: 2m3d A:2-95 [243090]
   Other proteins in same PDB: d2m3da2
   automated match to d2e29a1

Details for d2m3da1

PDB Entry: 2m3d

PDB Description: NMR structure of the GUCT domain from human DEAD box polypeptide 21

PDB Compounds: (A:) Nucleolar RNA helicase 2

SCOPe Domain Sequences for d2m3da1:

Sequence; same for both SEQRES and ATOM records:

>d2m3da1 d.58.7.0 (A:2-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hisgatsvdqrslinsnvgfvtmilqcsiempnisyawkelkeqlgeeidskvkgmvflk
gklgvcfdvptasvteiqekwhdsrrwqlsvate

Timeline for d2m3da1:

• d2m3da1 first appeared in SCOPe 2.04, called d2m3da_
  
• d2m3da1 was called d2m3da_ in SCOPe 2.05
  
• d2m3da1 appears in SCOPe 2.07
  
• d2m3da1 appears in the current release, SCOPe 2.08