Class b: All beta proteins [48724] (176 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
Protein automated matches [191109] (10 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [255476] (1 PDB entry) |
Domain d2m3ca1: 2m3c A:1-86 [243088] automated match to d1zira1 |
PDB Entry: 2m3c (more details)
SCOPe Domain Sequences for d2m3ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m3ca1 b.11.1.0 (A:1-86) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} mgkiifyedrnfggryhecmsdcadlhsyfnrchsirvesgcfmvydrtnfmgrqyflrr geypdymrtmgmndcvrscrmiplhh
Timeline for d2m3ca1: