SCOPe 2.05: Domain d2m3ca1: 2m3c A:1-86

Lineage for d2m3ca1 (2m3c A:1-86)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (10 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [255476] (1 PDB entry)

8. Domain d2m3ca1: 2m3c A:1-86 [243088]
   automated match to d1zira1

Details for d2m3ca1

PDB Entry: 2m3c

PDB Description: Solution Structure of gammaM7-Crystallin

PDB Compounds: (A:) Crystallin, gamma M7

SCOPe Domain Sequences for d2m3ca1:

Sequence; same for both SEQRES and ATOM records:

>d2m3ca1 b.11.1.0 (A:1-86) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mgkiifyedrnfggryhecmsdcadlhsyfnrchsirvesgcfmvydrtnfmgrqyflrr
geypdymrtmgmndcvrscrmiplhh

Timeline for d2m3ca1:

• d2m3ca1 first appeared in SCOPe 2.04
  
• d2m3ca1 appears in SCOPe 2.06
  
• d2m3ca1 appears in the current release, SCOPe 2.08