Lineage for d2m3ca1 (2m3c A:1-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773707Species Zebrafish (Danio rerio) [TaxId:7955] [255476] (1 PDB entry)
  8. 2773708Domain d2m3ca1: 2m3c A:1-86 [243088]
    automated match to d1zira1

Details for d2m3ca1

PDB Entry: 2m3c (more details)

PDB Description: Solution Structure of gammaM7-Crystallin
PDB Compounds: (A:) Crystallin, gamma M7

SCOPe Domain Sequences for d2m3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m3ca1 b.11.1.0 (A:1-86) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mgkiifyedrnfggryhecmsdcadlhsyfnrchsirvesgcfmvydrtnfmgrqyflrr
geypdymrtmgmndcvrscrmiplhh

SCOPe Domain Coordinates for d2m3ca1:

Click to download the PDB-style file with coordinates for d2m3ca1.
(The format of our PDB-style files is described here.)

Timeline for d2m3ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m3ca2