SCOPe 2.04: Domain d2m30a_: 2m30 A:

Lineage for d2m30a_ (2m30 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [109665] (3 PDB entries)
   Uniprot O85142

8. Domain d2m30a_: 2m30 A: [243083]
   automated match to d1r1uc_
   complexed with zn

Details for d2m30a_

PDB Entry: 2m30

PDB Description: Solution NMR refinement of a metal ion bound protein using quantum mechanical/molecular mechanical and molecular dynamics methods

PDB Compounds: (A:) repressor protein

SCOPe Domain Sequences for d2m30a_:

Sequence; same for both SEQRES and ATOM records:

>d2m30a_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
vkakrqgqsmiyslddihvatmlkqaihhanhpke

Timeline for d2m30a_:

• d2m30a_ is new in SCOPe 2.04-stable
  
• d2m30a_ appears in SCOPe 2.05
  
• d2m30a_ appears in the current release, SCOPe 2.08