SCOPe 2.01: Domain d1xnba_: 1xnb A:

Lineage for d1xnba_ (1xnb A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (17 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (11 PDB entries)

8. Domain d1xnba_: 1xnb A: [24308]
   complexed with so4

Details for d1xnba_

PDB Entry: 1xnb, 1.49 Å

PDB Description: high-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1xnba_:

Sequence; same for both SEQRES and ATOM records:

>d1xnba_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d1xnba_:

• d1xnba_ first appeared (with stable ids) in SCOP 1.55, called d1xnb__
  
• d1xnba_ appears in SCOP 1.75
  
• d1xnba_ appears in SCOPe 2.02
  
• d1xnba_ appears in the current release, SCOPe 2.08