SCOPe 2.06: Domain d2m2da1: 2m2d A:34-150

Lineage for d2m2da1 (2m2d A:34-150)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [256383] (3 PDB entries)

8. Domain d2m2da1: 2m2d A:34-150 [243078]
   Other proteins in same PDB: d2m2da2
   automated match to d3rrqa_

Details for d2m2da1

PDB Entry: 2m2d

PDB Description: Human programmed cell death 1 receptor

PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d2m2da1:

Sequence; same for both SEQRES and ATOM records:

>d2m2da1 b.1.1.1 (A:34-150) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
pptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqds
rfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvterrae

Timeline for d2m2da1:

• d2m2da1 first appeared in SCOPe 2.04, called d2m2da_
  
• d2m2da1 was called d2m2da_ in SCOPe 2.05
  
• d2m2da1 appears in SCOPe 2.07
  
• d2m2da1 appears in the current release, SCOPe 2.08