Lineage for d2m1za_ (2m1z A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851592Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1851718Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1851740Family c.44.2.0: automated matches [254256] (1 protein)
    not a true family
  6. 1851741Protein automated matches [254590] (4 species)
    not a true protein
  7. 1851754Species Listeria monocytogenes [TaxId:169963] [255474] (1 PDB entry)
  8. 1851755Domain d2m1za_: 2m1z A: [243077]
    automated match to d2r4qa1

Details for d2m1za_

PDB Entry: 2m1z (more details)

PDB Description: Solution structure of uncharacterized protein lmo0427
PDB Compounds: (A:) Lmo0427 protein

SCOPe Domain Sequences for d2m1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m1za_ c.44.2.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
mkrkiiavtacatgvahtymaaqalkkgakkmgnlikvetqgatgieneltekdvnigev
vifavdtkvrnkerfdgkvvlevpvsapikdaekvinaalalidek

SCOPe Domain Coordinates for d2m1za_:

Click to download the PDB-style file with coordinates for d2m1za_.
(The format of our PDB-style files is described here.)

Timeline for d2m1za_: