![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (14 proteins) |
![]() | Protein automated matches [190654] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries) |
![]() | Domain d2m1ra1: 2m1r A:188-249 [243076] Other proteins in same PDB: d2m1ra2 automated match to d1wena_ complexed with zn; mutant |
PDB Entry: 2m1r (more details)
SCOPe Domain Sequences for d2m1ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m1ra1 g.50.1.2 (A:188-249) automated matches {Human (Homo sapiens) [TaxId: 9606]} dmpvdpneptyclchqvsygemigcddpdcsiewfhfacvglttkprgkwfcprcsqerk kk
Timeline for d2m1ra1: