Lineage for d2a39b_ (2a39 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779929Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)
  7. 2779946Species Humicola insolens, Cel7b [TaxId:34413] [49977] (6 PDB entries)
  8. 2779954Domain d2a39b_: 2a39 B: [24307]
    complexed with nag

Details for d2a39b_

PDB Entry: 2a39 (more details), 2.2 Å

PDB Description: humicola insolens endocellulase egi native structure
PDB Compounds: (B:) endoglucanase I

SCOPe Domain Sequences for d2a39b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a39b_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Humicola insolens, Cel7b [TaxId: 34413]}
ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
finglgniegkgsccnemdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
eagpcakgegapsnivqvepfpevtytnlrwgeigsty

SCOPe Domain Coordinates for d2a39b_:

Click to download the PDB-style file with coordinates for d2a39b_.
(The format of our PDB-style files is described here.)

Timeline for d2a39b_: