Lineage for d2m0ua1 (2m0u A:11-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396113Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2396114Protein automated matches [190436] (9 species)
    not a true protein
  7. 2396128Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)
  8. 2396278Domain d2m0ua1: 2m0u A:11-120 [243067]
    Other proteins in same PDB: d2m0ua2
    automated match to d3ngha_

Details for d2m0ua1

PDB Entry: 2m0u (more details)

PDB Description: Complex structure of C-terminal CFTR peptide and extended PDZ1 domain from NHERF1
PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF1

SCOPe Domain Sequences for d2m0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m0ua1 b.36.1.0 (A:11-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpetdeqlqklgvqvreellraqeapgqa

SCOPe Domain Coordinates for d2m0ua1:

Click to download the PDB-style file with coordinates for d2m0ua1.
(The format of our PDB-style files is described here.)

Timeline for d2m0ua1: