Lineage for d2m0pa_ (2m0p A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703031Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 1703032Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 1703072Family g.12.1.0: automated matches [254261] (1 protein)
    not a true family
  6. 1703073Protein automated matches [254605] (1 species)
    not a true protein
  7. 1703074Species Human (Homo sapiens) [TaxId:9606] [255472] (1 PDB entry)
  8. 1703075Domain d2m0pa_: 2m0p A: [243063]
    automated match to d1j8ea_
    complexed with ca

Details for d2m0pa_

PDB Entry: 2m0p (more details)

PDB Description: Solution structure of the tenth complement type repeat of human megalin
PDB Compounds: (A:) Low-density lipoprotein receptor-related protein 2

SCOPe Domain Sequences for d2m0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m0pa_ g.12.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thapascldtqytcdnhqcisknwvcdtdndcgdgsdekncnstet

SCOPe Domain Coordinates for d2m0pa_:

Click to download the PDB-style file with coordinates for d2m0pa_.
(The format of our PDB-style files is described here.)

Timeline for d2m0pa_: