SCOPe 2.07: Domain d2m05a1: 2m05 A:135-197

Lineage for d2m05a1 (2m05 A:135-197)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families)
   automatically mapped to Pfam PF12924

5. Family d.230.3.0: automated matches [254260] (1 protein)
   not a true family

6. Protein automated matches [254604] (1 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255471] (1 PDB entry)

8. Domain d2m05a1: 2m05 A:135-197 [243056]
   Other proteins in same PDB: d2m05a2
   automated match to d2fjza_

Details for d2m05a1

PDB Entry: 2m05

PDB Description: Structure of module 2 from the E1 domain of C. elegans APL-1

PDB Compounds: (A:) Beta-amyloid-like protein

SCOPe Domain Sequences for d2m05a1:

Sequence; same for both SEQRES and ATOM records:

>d2m05a1 d.230.3.0 (A:135-197) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
cqfshvnsrdqcndyqhwkdeagkqcktkkskgnkdmivrsfavlepcaldmftgvefvc
cpn

Timeline for d2m05a1:

• d2m05a1 first appeared in SCOPe 2.04, called d2m05a_
  
• d2m05a1 appears in SCOPe 2.06
  
• d2m05a1 appears in the current release, SCOPe 2.08