![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) ![]() automatically mapped to Pfam PF12924 |
![]() | Family d.230.3.0: automated matches [254260] (1 protein) not a true family |
![]() | Protein automated matches [254604] (1 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255471] (1 PDB entry) |
![]() | Domain d2m05a1: 2m05 A:135-197 [243056] Other proteins in same PDB: d2m05a2 automated match to d2fjza_ |
PDB Entry: 2m05 (more details)
SCOPe Domain Sequences for d2m05a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m05a1 d.230.3.0 (A:135-197) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} cqfshvnsrdqcndyqhwkdeagkqcktkkskgnkdmivrsfavlepcaldmftgvefvc cpn
Timeline for d2m05a1: