Lineage for d2lzga_ (2lzg A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491226Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1491227Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1491228Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1491235Protein MDM2 [47594] (2 species)
  7. 1491253Species Human (Homo sapiens) [TaxId:9606] [47596] (41 PDB entries)
  8. 1491330Domain d2lzga_: 2lzg A: [243051]
    automated match to d4hbma_
    complexed with 13q

Details for d2lzga_

PDB Entry: 2lzg (more details)

PDB Description: NMR Structure of Mdm2 (6-125) with Pip-1
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d2lzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lzga_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgt
svsen

SCOPe Domain Coordinates for d2lzga_:

Click to download the PDB-style file with coordinates for d2lzga_.
(The format of our PDB-style files is described here.)

Timeline for d2lzga_: