SCOPe 2.08: Domain d2lz6b_: 2lz6 B:

Lineage for d2lz6b_ (2lz6 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)

8. Domain d2lz6b_: 2lz6 B: [243050]
   Other proteins in same PDB: d2lz6a_
   automated match to d1y0ma_

Details for d2lz6b_

PDB Entry: 2lz6

PDB Description: distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications

PDB Compounds: (B:) CD2-associated protein

SCOPe Domain Sequences for d2lz6b_:

Sequence; same for both SEQRES and ATOM records:

>d2lz6b_ b.34.2.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akeycrtlfpytgtnedeltfregeiihlisketgeagwwkgelngkegvfpdnfavqis

Timeline for d2lz6b_:

• d2lz6b_ first appeared in SCOPe 2.04
  
• d2lz6b_ appears in SCOPe 2.07