Lineage for d2lyva1 (2lyv A:1-98)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908892Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)
  8. 1908940Domain d2lyva1: 2lyv A:1-98 [243047]
    automated match to d1u1qa1

Details for d2lyva1

PDB Entry: 2lyv (more details)

PDB Description: Solution structure of the two RRM domains of hnRNP A1 (UP1) using segmental isotope labeling
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d2lyva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lyva1 d.58.7.1 (A:1-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfv
tyatveevdaamnarphkvdgrvvepkravsredsqrp

SCOPe Domain Coordinates for d2lyva1:

Click to download the PDB-style file with coordinates for d2lyva1.
(The format of our PDB-style files is described here.)

Timeline for d2lyva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lyva2