Lineage for d1dyma_ (1dym A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308326Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1308327Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1308344Species Humicola insolens, Cel7b [TaxId:34413] [49977] (6 PDB entries)
  8. 1308349Domain d1dyma_: 1dym A: [24304]
    complexed with nag; mutant

Details for d1dyma_

PDB Entry: 1dym (more details), 1.75 Å

PDB Description: humicola insolens endocellulase cel7b (eg 1) e197a mutant
PDB Compounds: (A:) endoglucanase I

SCOPe Domain Sequences for d1dyma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyma_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Humicola insolens, Cel7b [TaxId: 34413]}
ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
finglgniegkgsccnamdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
eagpcakgegapsnivqvepfpevtytnlrwgeigsty

SCOPe Domain Coordinates for d1dyma_:

Click to download the PDB-style file with coordinates for d1dyma_.
(The format of our PDB-style files is described here.)

Timeline for d1dyma_: